DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Sfp24F

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster


Alignment Length:159 Identity:45/159 - (28%)
Similarity:66/159 - (41%) Gaps:24/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIK--DEADL 180
            |.|.||:.|         ...|.:||:.||.||:..:|||..|.:.||.....|..::  ||..|
  Fly    26 GALEALQTT---------NDTFVRIGNSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRL 81

  Fly   181 AA---IKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPS------QLDTLNCVF- 235
            .:   :..|:.|  .||....||..:||.:....|:..:...|..|.|:      ..|.|...| 
  Fly    82 VSEYLLANNIFE--RYWTSGTDLGTKGKHVWFSNGQPLSTDLWYGGEPNNKNNEEHCDELGSDFR 144

  Fly   236 -LYNGEMYDYPCHYTFRFICQTEEEDLNV 263
             ..:..|.|..|::...|||:..:...||
  Fly   145 PTKSPGMNDRNCNFESSFICEEVQPKYNV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 34/121 (28%)
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 34/121 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43824
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.