DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and asgrl3

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_021332405.1 Gene:asgrl3 / 799269 ZFINID:ZDB-GENE-060526-152 Length:311 Species:Danio rerio


Alignment Length:268 Identity:54/268 - (20%)
Similarity:98/268 - (36%) Gaps:74/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QNLANSNNSSKANEVLVRQYTMEGQLTAL-------QNKQLS--------IEVALDAQGRKLNVN 105
            |:|......||...:||...|: |.:..|       |.|:||        :..:||:...|...|
Zfish    47 QSLCKGRPCSKQTGILVLLGTV-GMIIFLVLISIIVQAKKLSDIETLMTDLSSSLDSLTSKHEEN 110

  Fly   106 EQNFTERLNC----MEGILSALEKTVLEVKTKIKYLGFEQIGSKY--------YYIEKVSEK--- 155
            :|....:.|.    ::..:..:..:|..:.:|:|   .:.:.:.:        :.||..||:   
Zfish   111 QQKLERQQNVSYIQVKKQMDTVRASVSSIMSKLK---ADSVRTSFMFRHPLERFLIEHSSEELES 172

  Fly   156 ----------------------NWSTASKTCRNMGGHLADIKDEADLAAIK------ANLKEDTH 192
                                  ||:.|...|...|..|..|:|:::...::      .:....||
Zfish   173 GCSDSAWVPFGNSCYLFSRDKMNWTEAKDYCEEKGAWLLKIEDDSEDEWVRNECQFVTDFANPTH 237

  Fly   193 YWLGINDLDHEGKFLSMPTGKQTTFLK--WASGRPSQL-------DTLNCV-FLYNGEMYDYPCH 247
            ||:|:.| .:.|:: ....|...|..|  |..|:|.:.       :..:|. ..|...:.|..|.
Zfish   238 YWIGLTD-QNTGQW-RWADGTNYTMNKEHWGPGQPDEWTEHSLGEEGEDCAEITYESLLNDLHCS 300

  Fly   248 YTFRFICQ 255
            ...:|||:
Zfish   301 SKIKFICE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/157 (20%)
asgrl3XP_021332405.1 CLECT_DC-SIGN_like 179..309 CDD:153060 28/132 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.