DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec4g

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_083741.1 Gene:Clec4g / 75863 MGIID:1923113 Length:294 Species:Mus musculus


Alignment Length:272 Identity:65/272 - (23%)
Similarity:111/272 - (40%) Gaps:52/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKSASALLCGLLA---LNLYGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSN 62
            :|.|||:.|..||:   |....|..:...:..|||....|...|  .:|......|:::      
Mouse    52 LLSSASSKLRVLLSHQDLLRTNASEQKMTLSSLKDDIGACRNCC--SVTKAQLQTTLAE------ 108

  Fly    63 NSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTERLNCMEGILSALEKTV 127
                ..::..:....|..|..|| ::::.::|..::.|: |:..:.| :.|..::...|:.|   
Mouse   109 ----FKDIQAKLMEQESILKELQ-ERVTQDLAKASRDRE-NIRSELF-QALEAVKRQNSSCE--- 163

  Fly   128 LEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTH 192
               :....:|.|:  ||.||:.|  ::..|.||...|...|.||..::...:    :..|.:.|.
Mouse   164 ---QCPPSWLPFQ--GSCYYFSE--TQATWDTAQSYCGGQGAHLVIVRGLNE----QGFLSQHTR 217

  Fly   193 ---YWLGINDLDHEGKF--LSMPTGKQTTFLKWASGRPSQLDTL---NCV-FLYNGEMYDYPCHY 248
               ||||:..:.|..|.  .....|....|..|.||.|:  |:.   :|: .|::|...|.||  
Mouse   218 GRGYWLGLRAVRHLNKIQGYRWVDGASLNFSHWNSGEPN--DSRGHEDCIMMLHSGLWNDAPC-- 278

  Fly   249 TFRFICQTEEED 260
                   |.|.|
Mouse   279 -------TNERD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/117 (26%)
Clec4gNP_083741.1 COG6 61..>163 CDD:303003 21/116 (18%)
CLECT 165..289 CDD:295302 38/138 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.