DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Colec11

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001300907.1 Gene:Colec11 / 71693 MGIID:1918943 Length:278 Species:Mus musculus


Alignment Length:157 Identity:47/157 - (29%)
Similarity:79/157 - (50%) Gaps:16/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LSALEKTVLEVKTKIKYL-----------GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLAD 173
            :..::..|.::.|::|::           |..:..||.|.:.| .||.::.|..:|:..||.|:.
Mouse   123 IGEMDNQVTQLTTELKFIKNALPSPAAVAGVRETESKIYLLVK-EEKRYADAQLSCQARGGTLSM 186

  Fly   174 IKDEADLAAIKANLKED--THYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQ-LDTLNCV- 234
            .||||....:.:.|.:.  ...::|||||:.||.|:........||.||.||.|:. .|..:|| 
Mouse   187 PKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVE 251

  Fly   235 FLYNGEMYDYPCHYTFRFICQTEEEDL 261
            .:.:|...|..||.|..|:|:.::|:|
Mouse   252 MVASGGWNDVACHITMYFMCEFDKENL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 38/112 (34%)
Colec11NP_001300907.1 Collagen 48..99 CDD:460189
CLECT_collectin_like 158..273 CDD:153061 41/115 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.