DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec4b1

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001177239.1 Gene:Clec4b1 / 69810 MGIID:1917060 Length:209 Species:Mus musculus


Alignment Length:192 Identity:45/192 - (23%)
Similarity:79/192 - (41%) Gaps:40/192 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LSIEVALDAQGRKLNVNEQNFTERLNCM-EG------ILSALEKTVLEVKTKIKYLGFEQIGSKY 146
            ::.:.::|...|:|  :|.:....|.|. ||      :.|...|            .::..||..
Mouse    39 VTYQFSMDKPNRRL--SELDRYHSLTCFSEGNMVSDKVWSCCPK------------DWKLFGSHC 89

  Fly   147 YYIEKV-SEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDH-EGKFLSM 209
            |.:..| |..:|:.:.:.|..||.||..|..:.:...|...|.....|::|:.|..| :.:::..
Mouse    90 YLVPTVFSSASWNKSEENCSRMGAHLVVIHSQEEQDFITGILDIHAAYFIGLWDTGHRQWQWVDQ 154

  Fly   210 -PTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMY---------DYPCHYTFRFICQTEEEDL 261
             |..:..||  |.:|.||. |...||.:|    |         |..|:...:.:||.::.:|
Mouse   155 TPYEESVTF--WHNGEPSS-DNEKCVTVY----YRRNIGWGWNDISCNLKQKSVCQMKKINL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 30/120 (25%)
Clec4b1NP_001177239.1 CLECT_DC-SIGN_like 78..204 CDD:153060 34/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.