DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Cd209b

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_081248.4 Gene:Cd209b / 69165 MGIID:1916415 Length:325 Species:Mus musculus


Alignment Length:240 Identity:49/240 - (20%)
Similarity:101/240 - (42%) Gaps:46/240 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LTPVLNHLT----ISQNLANSNNSSKANEVLVRQYT--------MEGQLTALQNK----QLSIEV 93
            ||.:.:.||    |||. .|.:..:|..|.|::..|        .:||..::|.|    .:.::.
Mouse    94 LTQLTDELTSRIPISQG-KNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKA 157

  Fly    94 ALDAQGRKLNVNEQNFTERLNCMEGILSALEKTVLEVKTKI-----------KYLGFEQIGSKYY 147
            .|.::.....|.:.:..|:          :.:.::::||::           .:|    :|:.|:
Mouse   158 ELLSKISSFPVKDDSKQEK----------IYQQLVQMKTELFRLCRLCPWDWTFL----LGNCYF 208

  Fly   148 YIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMP-T 211
            :.:  |::||:.|...|:.:...|..|..:.:...::...|.....|:|::||..|..:|.:. :
Mouse   209 FSK--SQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGS 271

  Fly   212 GKQTTFLK-WASGRPSQLDTLNCVFLYNGEMYDYPCHYTFRFICQ 255
            ...:.|.| |..|.|:.:...:||........|..|.....:||:
Mouse   272 TLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 25/110 (23%)
Cd209bNP_081248.4 CLECT_DC-SIGN_like 195..317 CDD:153060 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.