DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Cd209c

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006248854.1 Gene:Cd209c / 688951 RGDID:1582956 Length:240 Species:Rattus norvegicus


Alignment Length:267 Identity:54/267 - (20%)
Similarity:91/267 - (34%) Gaps:86/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKSASALLC-GLLALNLYGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNS 64
            :||.|:..|| ||:...|       .:||     .:.|....|.:|..|       .|:|.|...
  Rat    39 ILKKAAGYLCHGLVPFVL-------QLIC-----LTLCAILLLAILIKV-------SNVAYSQGQ 84

  Fly    65 SKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTERLNCMEGILSALEKTVLE 129
            .:|.:..|.|                                                   .|.:
  Rat    85 EQAKKEKVYQ---------------------------------------------------DVAQ 98

  Fly   130 VKTKIKYL--------GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKAN 186
            :|.:|.:|        .|.| |:.|::.:  .::||..:..:||.:|..|..:|.:.:.:.::..
  Rat    99 LKPQINHLCRPCPWDWTFFQ-GNCYFFSK--FQQNWKDSVTSCRKLGAQLVVVKSDDEQSFLQQT 160

  Fly   187 LKEDTHYWLGINDLDHEGKFLSMPTGKQT--TFLK-WASGRPSQLDTLNCVFLYNGEMYDYPCHY 248
            .||..:.|:.::||..|| ......|...  :|.| |..|.|:.....:|.........|.||..
  Rat   161 SKEKGYAWMVLSDLKREG-IWHWVDGSHLLFSFTKYWNKGEPNNEWEEDCAEFRGDGWNDAPCTN 224

  Fly   249 TFRFICQ 255
            ...:||:
  Rat   225 KKYWICK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 26/111 (23%)
Cd209cXP_006248854.1 CLECT_DC-SIGN_like 110..232 CDD:153060 30/126 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.