DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Cd209f

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_001068161.4 Gene:Cd209f / 688750 RGDID:1585258 Length:277 Species:Rattus norvegicus


Alignment Length:247 Identity:48/247 - (19%)
Similarity:96/247 - (38%) Gaps:61/247 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LANSNNSSKANEVLVRQYTMEGQLTALQNKQ---------LSIEVALD---------AQGRKLNV 104
            |...||..:  ||.:..:..||.:.:.::.|         |.:.::|.         .|..::..
  Rat    28 LHQPNNHEE--EVTLEDHDPEGLICSSKSLQGHLTRAPWLLPLLISLGLFLLMLATLVQISRICA 90

  Fly   105 NEQNFTERLNCMEGILSALEKTVLEVKTKIKYLGFEQI--------------------------- 142
            |.|..|:.   .:|..|..:..|.:.:|   |.|.|||                           
  Rat    91 NPQGQTQD---QKGSSSFGKVAVPQEQT---YTGLEQIQQIQQQLTQFNASLAGLCRPCPWDWEF 149

  Fly   143 --GSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKA-NLKEDTHYWLGINDLDHEG 204
              ||.|.:...::  :|..::.:|:::|.||..:...|:...:|. ::::....|:|::|...||
  Rat   150 FQGSCYLFSRTLA--SWGASASSCKDLGAHLVIVNSVAEQQFLKYWHIRQSQLTWIGLSDHQREG 212

  Fly   205 KFLSM-PTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMYDYPCHYTFRFICQ 255
            .:..: .|..:.:|  |..|.|:.....:||.:...:..|..|.....::|:
  Rat   213 SWQWVDDTPLKLSF--WKEGEPNNAGDEDCVVIAEDKWNDSTCSANNFWVCE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 22/110 (20%)
Cd209fXP_001068161.4 CLECT_DC-SIGN_like 143..262 CDD:153060 24/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.