DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and illr3

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_021323809.1 Gene:illr3 / 677740 ZFINID:ZDB-GENE-050311-4 Length:285 Species:Danio rerio


Alignment Length:245 Identity:66/245 - (26%)
Similarity:107/245 - (43%) Gaps:55/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NSSKANEVLVRQYTME-----GQLTALQNKQLSIEVALDAQ-------GRKLNVNEQNFT---ER 112
            |::|..:||:..:.:.     |.|.|::.:.:|:...|.||       .|:|:....|||   :.
Zfish    39 NTAKWTKVLLIVFAVSLVFALGGLCAVRIQYVSVSAQLSAQETNGTIMSRQLDKLTANFTTVRDH 103

  Fly   113 LNCMEGILSALEKTVLEVKTKI--------KYLGFEQ-------------IGSKYYYIEKVSEKN 156
            |:..|.::..|......||.::        |...|.|             .|.|.||...| :.|
Zfish   104 LHINELLMKELTANYSRVKEQLSISEETVRKLSRFNQSSGCAICAIHWTHSGEKCYYFSTV-KMN 167

  Fly   157 WSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFL---SMPTGKQTTF- 217
            |:.:...|...||||..|..:|:...:.:|:|| || |:|:||||.||::|   :.|..:...| 
Zfish   168 WTQSRDHCVTKGGHLVIITSQAEQEFLTSNVKE-TH-WIGLNDLDTEGRWLWVDNQPLSQTEEFW 230

  Fly   218 LKWASG-------RPSQLDTLNCVFL--YNGEMYDYPCHYTF---RFICQ 255
            :|..:|       ....:|..:|..|  .:||...:...|.|   ||:|:
Zfish   231 MKRENGVSEPDNWTKQHVDGEDCASLGHPDGETDFWTDAYCFEEKRFVCE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 39/124 (31%)
illr3XP_021323809.1 CLECT_DC-SIGN_like 147..280 CDD:153060 41/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.