DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and SFTPA1

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_054222603.1 Gene:SFTPA1 / 653509 HGNCID:10798 Length:276 Species:Homo sapiens


Alignment Length:157 Identity:34/157 - (21%)
Similarity:65/157 - (41%) Gaps:17/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KLNVNEQNFTERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCR 165
            :|.....:|..::....|.|| |:.:::.|..|:    |...|...         .:....:.|.
Human   134 ELQATLHDFRHQILQTRGALS-LQGSIMTVGEKV----FSSNGQSI---------TFDAIQEACA 184

  Fly   166 NMGGHLADIKDEADLAAIKANLKE-DTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLD 229
            ..||.:|..::..:..||.:.:|: :|:.::|:.:....|.| ....|....:..|..|.|:...
Human   185 RAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDF-RYSDGTPVNYTNWYRGEPAGRG 248

  Fly   230 TLNCVFLY-NGEMYDYPCHYTFRFICQ 255
            ...||.:| :|:..|..|.|:...||:
Human   249 KEQCVEMYTDGQWNDRNCLYSRLTICE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 23/110 (21%)
SFTPA1XP_054222603.1 Collagen 56..128 CDD:460189
CLECT_collectin_like 164..276 CDD:153061 27/126 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.