DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and SFTPD

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_003010.4 Gene:SFTPD / 6441 HGNCID:10803 Length:375 Species:Homo sapiens


Alignment Length:154 Identity:37/154 - (24%)
Similarity:72/154 - (46%) Gaps:17/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 ERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYY----YIEKVSEKNWSTASKTCRNMGGHL 171
            :::..::|.:..|:....:.|....:...:.:|.|.:    :::..:|     |...|...||.|
Human   229 QQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTE-----AQLLCTQAGGQL 288

  Fly   172 ADIKDEADLAAIKANL--KEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLD--TLN 232
            |..:..|:.||::..:  |.:..: |.:.|...|||| :.|||:...:..||.|.|:. |  :.:
Human   289 ASPRSAAENAALQQLVVAKNEAAF-LSMTDSKTEGKF-TYPTGESLVYSNWAPGEPND-DGGSED 350

  Fly   233 CVFLY-NGEMYDYPCHYTFRFICQ 255
            ||.:: ||:..|..|......:|:
Human   351 CVEIFTNGKWNDRACGEKRLVVCE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/117 (26%)
SFTPDNP_003010.4 gly_rich_SclB <44..>220 CDD:468478
Surfac_D-trimer 224..269 CDD:286141 5/39 (13%)
CLECT_collectin_like 262..375 CDD:153061 33/121 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.