DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec10a

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:252 Identity:50/252 - (19%)
Similarity:101/252 - (40%) Gaps:70/252 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTERLNCME 117
            |:...|.|:.:::||.   ::.....|.  :||....|::|.:|..|::|... :..::::..:|
  Rat    70 TLRTTLDNTTSNTKAE---LQALASRGD--SLQTGINSLKVEVDDHGQELQAG-RGLSQKVASLE 128

  Fly   118 GILSALEKT----VLEVKTKIKYLG---------------------------FEQIGSKYYYIEK 151
            ..:...|:|    :.|:..:::.||                           .|..||.|::.: 
  Rat   129 STVEKKEQTLRTDLSEITDRVQQLGKDLKTLTCQLASLKNNGSAVACCPLHWMEHEGSCYWFSQ- 192

  Fly   152 VSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKED---THY-----WLGINDLDHEGKFLS 208
             |.|.|..|.|.|:         .:.::|.|:.:..:::   ||.     |:|:.|.:...:::.
  Rat   193 -SGKPWPEADKYCQ---------LENSNLVAVNSLAEQNFLQTHMGSVVTWIGLTDQNGPWRWVD 247

  Fly   209 MPTGKQTTFLKWASGRPSQLDTL---------NCV-FLYNGEMYDYPCHYTFRFICQ 255
             .|..:..|..||   |.|.|..         :|. |..:|...|..|...:|::|:
  Rat   248 -GTDYEKGFTHWA---PKQPDNWYGHGLGGGEDCAHFTSDGRWNDDVCQRPYRWVCE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 27/126 (21%)
Clec10aXP_008766090.1 Lectin_N 21..166 CDD:281887 19/101 (19%)
Apolipoprotein <63..166 CDD:279749 19/101 (19%)
CLECT_DC-SIGN_like 176..301 CDD:153060 31/140 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.