DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and REG1B

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_006498.1 Gene:REG1B / 5968 HGNCID:9952 Length:166 Species:Homo sapiens


Alignment Length:167 Identity:38/167 - (22%)
Similarity:72/167 - (43%) Gaps:35/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LNVNEQNFTE----RLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASK 162
            |:..:::.||    |::|.||..:              |..:     .||:.|  ..:.|..|..
Human    19 LSQGQESQTELPNPRISCPEGTNA--------------YRSY-----CYYFNE--DPETWVDADL 62

  Fly   163 TCRNM-GGHLADIKDEADLAAIKANLKE----DTHYWLGINDLDHEGKFLSMPTGKQTTFLKWAS 222
            .|:|| .|:|..:..:|:.|.:.:.:||    |::.|:|::| ..:.:.....:|...::..|.:
Human    63 YCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHD-PKKNRRWHWSSGSLVSYKSWDT 126

  Fly   223 GRPSQLDTLNCVFLYNGEMY----DYPCHYTFRFICQ 255
            |.||..:...|..|.:...:    |..|...|.|:|:
Human   127 GSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 29/117 (25%)
REG1BNP_006498.1 CLECT 36..164 CDD:470576 34/150 (23%)

Return to query results.
Submit another query.