DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec4n

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_064385.1 Gene:Clec4n / 56620 MGIID:1861231 Length:209 Species:Mus musculus


Alignment Length:128 Identity:37/128 - (28%)
Similarity:54/128 - (42%) Gaps:12/128 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 FEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHE 203
            ::..||..|.| ...|..|||:.:.|..||.||..|..||:...|...|.|...|:||::|....
Mouse    83 WKSFGSSCYLI-STKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGN 146

  Fly   204 GKFL---SMPTGKQTTFLKWASGRPSQLDTLNCVFL--YNGEMY---DYPCHYTFRFICQTEE 258
            ||:.   ..|..:...|  |....|: |....||.:  :|...:   |..|......||:.::
Mouse   147 GKWQWIDDTPFSQNVRF--WHPHEPN-LPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKK 206

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 34/116 (29%)
Clec4nNP_064385.1 CLECT_DC-SIGN_like 79..204 CDD:153060 37/124 (30%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000250|UniProtKB:Q6EIG7 168..170 0/1 (0%)