DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec4e

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_064332.1 Gene:Clec4e / 56619 MGIID:1861232 Length:214 Species:Mus musculus


Alignment Length:175 Identity:45/175 - (25%)
Similarity:74/175 - (42%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RKLNVNEQNFTERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTC 164
            |...::.||.....|..|  ||...:....||.... |.::...|..|:. ..:...||::.|.|
Mouse    48 RSSQISGQNLQPHRNIKE--LSCYSEASGSVKNCCP-LNWKHYQSSCYFF-STTTLTWSSSLKNC 108

  Fly   165 RNMGGHLA--DIKDEAD-LAAIKANLKEDTHYWLGINDLDHEGKFL---SMPTGKQTTFLKWASG 223
            .:||.||.  |.::|.: |...|...||   :::|:.|...||::.   ..|..:..:|  |.:|
Mouse   109 SDMGAHLVVIDTQEEQEFLFRTKPKRKE---FYIGLTDQVVEGQWQWVDDTPFTESLSF--WDAG 168

  Fly   224 RPSQL----------DTLNCVFLYNGEMYDYPCHYTFRFICQTEE 258
            .|:.:          |:.|....:|    |.||.|:..:||:..|
Mouse   169 EPNNIVLVEDCATIRDSSNSRKNWN----DIPCFYSMPWICEMPE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 32/124 (26%)
Clec4eNP_064332.1 CLECT_DC-SIGN_like 80..207 CDD:153060 35/137 (26%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000250|UniProtKB:Q9ULY5 169..171 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.