DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and si:dkey-241l7.5

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_068071615.1 Gene:si:dkey-241l7.5 / 565442 ZFINID:ZDB-GENE-041014-237 Length:157 Species:Danio rerio


Alignment Length:116 Identity:30/116 - (25%)
Similarity:53/116 - (45%) Gaps:22/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 ERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIK 175
            |||:|..                    |:.:.||:.:.....| .||.||.:.|:::||:||.:.
Zfish    27 ERLSCER--------------------GWSRSGSRCFRFFSRS-VNWVTAERNCQSLGGNLASVH 70

  Fly   176 DEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPS 226
            |:.:...:.:.:...|..|:|.:|.:.:|::| ...|....:..|.||.||
Zfish    71 DQVENDFLLSLVPGSTRCWIGGHDGEQDGQWL-WSDGSVYGYTNWCSGEPS 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 23/81 (28%)
si:dkey-241l7.5XP_068071615.1 CLECT 31..150 CDD:214480 27/112 (24%)

Return to query results.
Submit another query.