DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and si:ch73-86n18.1

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001038504.2 Gene:si:ch73-86n18.1 / 564061 ZFINID:ZDB-GENE-141216-19 Length:263 Species:Danio rerio


Alignment Length:235 Identity:49/235 - (20%)
Similarity:94/235 - (40%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SQCGGFCLGVLTPVLNHLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQG 99
            |.|....||||            |.||..||.:.|.:    ..|.:...|              .
Zfish    56 SVCANIGLGVL------------LVNSRRSSISAEPV----NSESEAATL--------------S 90

  Fly   100 RKLNVNEQNFTERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTC 164
            .||...::.|:...:....:..|..|:|::.:...:  .:..:..|.||... .:.:|..:.::|
Zfish    91 LKLTATQERFSRLCSEYTNLGQACSKSVIKCRPCPE--DWMHLSEKCYYFSD-DKLDWQHSKESC 152

  Fly   165 RNMGGHLADIKDEADLAAIKANLKE----DTHYWLGINDLDHEG--KFLSMPTGKQTTFLKWA-- 221
            .:|||||..:........::|..:.    |.|:|:|::|.:.||  |::......:|.:.:|.  
Zfish   153 ASMGGHLTILHSHEQHHTLEAVARNHGGMDYHFWIGLSDTETEGVWKWVDNTVVNKTYWNEWEKE 217

  Fly   222 --SGRPSQLDTLNCVFL--YNGEMYDYPCHYTFRFICQTE 257
              :.|...:...:|..|  .:...:|.||.:.::.||:.:
Zfish   218 PNNHRSGGVHGEDCAVLDSRSKTWFDVPCDFHYKRICEMD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 27/120 (23%)
si:ch73-86n18.1NP_001038504.2 CLECT_DC-SIGN_like 124..256 CDD:153060 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.