DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and illr4

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001035129.1 Gene:illr4 / 559737 ZFINID:ZDB-GENE-050311-5 Length:259 Species:Danio rerio


Alignment Length:259 Identity:61/259 - (23%)
Similarity:95/259 - (36%) Gaps:62/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CPLKDPPSQCGGFCLGVLTPV----------LNHLTISQNLANSNNSSKANEVLVRQYTMEGQLT 82
            |.|:...|.|.|..| |||.:          |:.|...|..:|.|...|..:       ::....
Zfish    29 CDLQKRRSCCDGVRL-VLTALCVIFTTGLIALSFLCYMQATSNHNFQKKLQD-------LQEVHD 85

  Fly    83 ALQNKQLSIEVALDAQGRKLNVNEQNFTERLN----CMEGILSALEKTVLEVKTKIKYLGFEQIG 143
            |||....:....|:    .:...|||.:..||    |.|               ..:|    ..|
Zfish    86 ALQENFTAFSAVLE----HIYNREQNLSRALNNSAQCPE---------------DWQY----HAG 127

  Fly   144 SKYYYIEKVSEKNWSTASKTCRNMGGHLADI--KDEADLAAIKANLKEDTHYWLGINDLDHEGKF 206
            ..||:....:..:|..:...|.:.||||..|  :||.:....|.| |....:|:|:.|...||::
Zfish   128 KCYYFSSNTNTLDWFKSRDACISDGGHLVIINNRDEQEFLMSKTN-KYKGSFWIGLTDKSTEGQW 191

  Fly   207 LSMPTGKQTTFLK---------WASGRPSQLDTLNCVFL----YN-GEMYDYPCHYTFRFICQT 256
            |.:...|.:|.::         |...|....:..:|..:    :| ...:|..|...||.||:|
Zfish   192 LWVDNTKLSTDIRYWNGQEPDNWKGYRNEYTEGEDCARIEQNNWNINSWFDAFCTIAFRRICET 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/124 (25%)
illr4NP_001035129.1 CLECT_DC-SIGN_like 118..255 CDD:153060 36/156 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.