DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and lectin-21Ca

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster


Alignment Length:276 Identity:93/276 - (33%)
Similarity:130/276 - (47%) Gaps:32/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKSASALLCGLLALNLYGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLA---NSN 62
            |.:.|:..|...:|..|||..|:.  :||......:   .||..|.|||.:  ||.|..   ||.
  Fly     1 MFQHANFFLHVFMACGLYGIRAKD--VCPRMSTDKE---VCLVELAPVLKY--ISNNHKSHWNSA 58

  Fly    63 NSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNV------NEQNFTERLNCMEGILS 121
            |..:.||...:...:|||.....:|   |:|..|....:.|.      |.:|....|..:|..|.
  Fly    59 NEVQVNETRKQLAKIEGQEKETNDK---IKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQ 120

  Fly   122 ALEKTV-LEV-------KTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEA 178
            ..:|.: |.|       ||:|. ..|::||.::::|||..:.:|..|:..|..||.||..|:.|.
  Fly   121 ETKKALNLSVEAKKVMPKTEIP-SQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSED 184

  Fly   179 DLAAIKANLK---EDTH-YWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNG 239
            :|.||:..||   :.:| :||.|||:...|:|:|:.||....||||...||.......||.|..|
  Fly   185 ELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGG 249

  Fly   240 EMYDYPCHYTFRFICQ 255
            ||.|..|...|.||||
  Fly   250 EMMDGKCSEQFLFICQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 45/112 (40%)
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 42/106 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448773
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 1 1.000 - - X29
109.930

Return to query results.
Submit another query.