DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and lectin-24A

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster


Alignment Length:277 Identity:87/277 - (31%)
Similarity:130/277 - (46%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLALNL------YGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNSSKANEV 70
            :|.|||      :.|......|.||   |:.|.|:|...|.||:.::.|.|:..|:.....|||.
  Fly     6 VLVLNLLLVSHEFSAGTAKIEIQPL---PALCNGYCFPTLKPVMEYVAIHQDKWNTCTEILANEA 67

  Fly    71 LVRQYTMEGQLTALQNKQLSIEVALDAQGRKLN-VNEQNFT--ERLNCMEGILSA-LEKTVLE-- 129
            ...|..:..||.||:....:|:.:..::..||: :..:.|.  |.|..:...|:. |::|.|:  
  Fly    68 RKDQIQLNIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETINRYLTVKLDRTKLQLE 132

  Fly   130 -VKTKIKYL-------------------GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADI 174
             :|..:.|:                   |||:||.:|:|||:..|.||..|...||.||||||.|
  Fly   133 AIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASI 197

  Fly   175 KDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRP-SQLDTLNCVFLYN 238
            |.:.:..||...|.:...|:||:|:....|.|:|..:||...:.:|..|.| ...|...||.:..
  Fly   198 KTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILR 262

  Fly   239 GEMYDYPCHYTFRFICQ 255
            ..|:...|.|..|||||
  Fly   263 KLMHVGNCTYEKRFICQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 42/109 (39%)
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 44/111 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448779
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
98.900

Return to query results.
Submit another query.