DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and lectin-46Ca

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster


Alignment Length:139 Identity:35/139 - (25%)
Similarity:58/139 - (41%) Gaps:26/139 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 YLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHY------- 193
            ||  .::..|.:|: .:.:.||..|...|...|.:|||:....|..|:       .||       
  Fly    36 YL--RELNGKCFYV-GIKKINWFGAQNNCLRKGLNLADVSTMEDFKAV-------VHYVTSQVGF 90

  Fly   194 ---WLGINDLDHEGKFLSMPTGKQTTFLKWAS-GRPSQLDTL-NCVFLYNGE----MYDYPCHYT 249
               |.|.|||..||:|..:.:||...::..:: ..|:|...| :|:.:....    :.|..|...
  Fly    91 DDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEK 155

  Fly   250 FRFICQTEE 258
            ..|||:..:
  Fly   156 KYFICEQNQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/124 (25%)
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 33/126 (26%)

Return to query results.
Submit another query.