DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and lectin-46Cb

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001163102.1 Gene:lectin-46Cb / 53522 FlyBaseID:FBgn0040092 Length:322 Species:Drosophila melanogaster


Alignment Length:164 Identity:43/164 - (26%)
Similarity:66/164 - (40%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 MEGILSALEKTVLEVKTKIKYLG---------FEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHL 171
            |:.:|:|| ..:|.:..:.:.||         ..:|..|.||. .|.:.||..|...|...|..|
  Fly     1 MKHLLTAL-VALLSILPRGELLGSGPPCPRRYLRRINGKCYYF-SVKKMNWFGALNNCLRKGLTL 63

  Fly   172 ADIKDEADL---AAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFL-KWASGRP---SQLD 229
            ||:.::.|.   ....:.|.....:|.|.|||.|||:|..:..|:...:. .:::..|   |:.|
  Fly    64 ADLSNQRDFDGAIGFLSGLGNTEDFWFGGNDLYHEGRFQYISNGRLVRYYSNYSNVLPLEHSECD 128

  Fly   230 ---------TLNCVFLYNGEMYDYPCHYTFRFIC 254
                     .:|.|...|       ||....|||
  Fly   129 DCLEVRIRSEINMVSADN-------CHERQYFIC 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 34/125 (27%)
lectin-46CbNP_001163102.1 CLECT 38..155 CDD:153057 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.