DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and lectin-33A

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster


Alignment Length:162 Identity:45/162 - (27%)
Similarity:75/162 - (46%) Gaps:23/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 CMEG----ILSALEKTVLE-VKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADI 174
            |::|    :|.||   :|| ...:...|.|.::|:|.|:: .:.|.||..|.::||.:|..|..:
  Fly     2 CIKGSFGFLLIAL---ILECANAQTCPLPFSRVGNKCYHV-SLQEANWHVADRSCRKLGAELMVL 62

  Fly   175 KDEAD-------LAAIKANLKEDTHY--WLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLD- 229
            .::.|       |.::..:..:..|:  |.|||.|.:...||....|:...:|.|....|:... 
  Fly    63 DNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASP 127

  Fly   230 TLNCVFL--YNGEM--YDYPCHYTFRFICQTE 257
            ..:||..  |||..  :|..|...|.::||.|
  Fly   128 EEDCVGFANYNGAFGYHDIECKVQFPYVCQRE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/122 (25%)
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.