DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec4f

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_058031.2 Gene:Clec4f / 51811 MGIID:1859834 Length:548 Species:Mus musculus


Alignment Length:232 Identity:51/232 - (21%)
Similarity:95/232 - (40%) Gaps:58/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEV--ALDA--QGRKLNVNEQNFTERL 113
            |:.::|  |:.|:..:.|.:.|..::...|.:|:.:..::.  ||.|  ||      |||   ||
Mouse   335 TLRRDL--SDVSALKSNVQMLQSNLQRAKTEMQSLKADLQATKALTAKIQG------EQN---RL 388

  Fly   114 NCMEGILSALEKTVLEVKTKIKYL-----GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLAD 173
            ..::..::|.::   |.||:.:.|     .::.....:||..: .:|.|..|.|.|.:.|.|||.
Mouse   389 GALQEAVAAQKQ---EQKTQNQVLQLIAQNWKYFNGNFYYFSR-DKKPWREAEKFCTSQGAHLAS 449

  Fly   174 IKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRP------------S 226
            :..:.:.|.:........| |:|:.|...||            ..:|..|.|            :
Mouse   450 VTSQEEQAFLVQTTSSGDH-WIGLTDQGTEG------------IWRWVDGTPFNNAQSKGFWGKN 501

  Fly   227 QLDTL--------NCVFLYNGEMYDYPCHYTFRFICQ 255
            |.|..        :||.: ..:..|..|..::.::|:
Mouse   502 QPDNWRHRNGEREDCVHV-RQQWNDMACGSSYPWVCK 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 27/128 (21%)
Clec4fNP_058031.2 PhageMin_Tail 144..411 CDD:304511 23/89 (26%)
MscS_porin 222..415 CDD:289559 23/93 (25%)
CLECT_DC-SIGN_like 414..538 CDD:153060 28/139 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.