DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CD207

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_056532.4 Gene:CD207 / 50489 HGNCID:17935 Length:328 Species:Homo sapiens


Alignment Length:222 Identity:52/222 - (23%)
Similarity:88/222 - (39%) Gaps:43/222 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SQNLANSNNSSKAN---EVLVRQY----TMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTER 112
            ||.|....:..|||   ::|.|.:    |:..|:..|:: .|....||:.:.|.|..:.:|.::.
Human   121 SQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKS-DLEKASALNTKIRALQGSLENMSKL 184

  Fly   113 LNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDE 177
            |.....||..:.:            |::.....:||...: .|.|.:|.:.|.:...||..:..|
Human   185 LKRQNDILQVVSQ------------GWKYFKGNFYYFSLI-PKTWYSAEQFCVSRNSHLTSVTSE 236

  Fly   178 AD---LAAIKANLKEDTHYWLGINDLDHEGKFL---SMPTGKQTTFLKWASGRPSQL-DTLNC-- 233
            ::   |......|    .||:|:.....||.:.   ..|..|..:...|..|.|:.. :..:|  
Human   237 SEQEFLYKTAGGL----IYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGN 297

  Fly   234 -----VFLYNGEMYDYPCHYTFRFICQ 255
                 :..:|    |.||..||.|||:
Human   298 IKAPSLQAWN----DAPCDKTFLFICK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 30/122 (25%)
CD207NP_056532.4 CLECT_DC-SIGN_like 196..321 CDD:153060 32/146 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.