DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Cd207

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_578352.4 Gene:Cd207 / 502852 RGDID:1565913 Length:332 Species:Rattus norvegicus


Alignment Length:316 Identity:61/316 - (19%)
Similarity:112/316 - (35%) Gaps:107/316 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PLKDPPSQ------------CGGF-CL-----------GVLTPVL-------------------N 50
            |.:.||.|            |..| ||           .|..|.|                   |
  Rat    27 PREPPPKQDLTPVLRKPHCICAAFICLALVLVTSIVLQAVFYPRLMGKILDVKSDAQMLRGRVDN 91

  Fly    51 HLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTE--RL 113
            ..|:..:|  .....:.::..|:...:...|..:::|.||:|.::.....:|.|...|:.|  .|
  Rat    92 ISTLGSDL--KRERGRVDDAEVQMRIVNTSLGRVRSKILSLEASMKIVSNQLQVLTMNWGEVDNL 154

  Fly   114 NC------------------MEGILSALE---------KTVLEVKTKIKYLGFEQIGSKYYYIEK 151
            |.                  ::|:.::||         ..:||:.::    |::.....:||..:
  Rat   155 NAKIPELQKDLDKASALNTKVQGLQNSLENINKLLKEQSDILEMMSR----GWKYFMGNFYYFSR 215

  Fly   152 VSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTT 216
             :.|.|.:|.:.|.:...||..:..|::...: ..:.:...:|:|:.....||.:..:   .||:
  Rat   216 -TPKTWYSAEQYCISRKAHLTSVSSESEHEFL-YKVADGIPHWIGLTKAGSEGDWYWV---DQTS 275

  Fly   217 FLK------WASGRPS-----------QLDTLNCVFLYNGEMYDYPCHYTFRFICQ 255
            |.|      |..|.|:           ::..|.|   :|    |.||...:.|||:
  Rat   276 FNKEQSRRFWIPGEPNNVRNNEHCANIRVSALKC---WN----DSPCDNVYSFICK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 28/125 (22%)
Cd207XP_578352.4 DUF881 127..>190 CDD:303034 12/62 (19%)
CLECT_DC-SIGN_like 202..325 CDD:153060 30/135 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.