DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and colec10

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001011227.1 Gene:colec10 / 496663 XenbaseID:XB-GENE-945586 Length:275 Species:Xenopus tropicalis


Alignment Length:146 Identity:42/146 - (28%)
Similarity:71/146 - (48%) Gaps:10/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ILSALEKTVLEVKTKIKYL-----GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEA 178
            ::..|:..|..:|:.:|::     |..:...|||||.: .|:|:..|...||..||.||..||:|
 Frog   125 VVGQLDVNVAHLKSSLKFVKNVIAGIRETDEKYYYIVR-EERNYRDALTQCRIRGGTLAMPKDQA 188

  Fly   179 DLAAIKANLKEDTHY--WLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTL-NCV-FLYNG 239
            ..:.|...:.:...:  ::||||::.|.:|:........|:..|.:|.|:..... :|| .|..|
 Frog   189 TNSLIADYISKMGLFRVFIGINDIEKEKQFVYADNSPLQTYSSWKAGEPNDGSGYEDCVEMLSTG 253

  Fly   240 EMYDYPCHYTFRFICQ 255
            ...|..|..|..|:|:
 Frog   254 HWNDVDCSLTIYFVCE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 35/112 (31%)
colec10NP_001011227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..76
gly_rich_SclB <45..>99 CDD:468478
CLECT_collectin_like 155..270 CDD:153061 37/116 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.