DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and colec11

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_009291466.1 Gene:colec11 / 492459 ZFINID:ZDB-GENE-041114-11 Length:277 Species:Danio rerio


Alignment Length:156 Identity:45/156 - (28%)
Similarity:79/156 - (50%) Gaps:16/156 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ILSALEKTVLEVKTKIKYL-----------GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLA 172
            ::..::..|:::..::|::           |.::..||.|.:.| .||.:..|...|:..|||||
Zfish   121 MIGEMDIQVVQLTNELKFIKNALPSPAAVAGIKETDSKVYLLVK-EEKRYREAEVFCQGRGGHLA 184

  Fly   173 DIKDEADLAAIKANLKED--THYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQ-LDTLNCV 234
            ..||.|...||...:.:.  :..::|||||:.||.|:.:.....|||.:|..|.|:. .|..:||
Zfish   185 MPKDAAANRAIAGYVTDAGLSRVYIGINDLEREGHFVYVERSPMTTFSRWREGEPNNAYDDEDCV 249

  Fly   235 -FLYNGEMYDYPCHYTFRFICQTEEE 259
             .:.:||..|..|..|..|:|:.:::
Zfish   250 EMVSSGEWIDVACQLTMYFVCEFDKD 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 39/112 (35%)
colec11XP_009291466.1 Collagen 44..102 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 42/115 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26609
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.