DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec4e

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001005897.2 Gene:Clec4e / 450223 RGDID:1359298 Length:215 Species:Rattus norvegicus


Alignment Length:164 Identity:37/164 - (22%)
Similarity:65/164 - (39%) Gaps:45/164 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 KTV------LEVKTKIKY---LGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADI---KDE 177
            ||:      ||....:|.   |.::...|..|:. ..:...|.::...|.:||.||..|   :::
  Rat    62 KTIKELSCYLEASGSVKNCCPLNWKHFQSSCYFF-STTTLTWPSSLNNCSDMGAHLVVINTWEEQ 125

  Fly   178 ADLAAIKANLKEDTHYWLGINDLDHEGKFL---SMPTGKQTTFLKWASGRPSQLDTLNCVFL--- 236
            ..|...|...||   :::|:.|...||::.   ..|..:..:|  |.:|.|:     |.||:   
  Rat   126 EFLFRTKPRKKE---FYIGLTDQVVEGQWRWVDDTPFTESLSF--WDAGEPN-----NIVFVEDC 180

  Fly   237 ------------YNGEMYDYPCHYTFRFICQTEE 258
                        :|    |..|.::..:||:..|
  Rat   181 ATMRDSSNPRKNWN----DVSCFFSMPWICEMPE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 28/129 (22%)
Clec4eNP_001005897.2 CLECT_DC-SIGN_like 81..208 CDD:153060 31/141 (22%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000250|UniProtKB:Q9ULY5 170..172 0/1 (0%)

Return to query results.
Submit another query.