DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec3a

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001007224.1 Gene:Clec3a / 403395 MGIID:2685642 Length:196 Species:Mus musculus


Alignment Length:152 Identity:43/152 - (28%)
Similarity:72/152 - (47%) Gaps:14/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EGILSALEKTVLEVKTKIKYLGFEQI---GSKYY---YIEKVSEKNWSTASKTCRNMGGHLADIK 175
            :.:.|.:||...||....:....:.:   |:|.:   |:.....|::..|::.|.:.||.|...:
Mouse    42 DDLKSQVEKLWREVNALKEMQALQTVCLRGTKVHKKCYLASEGLKHYHEANEDCISKGGTLVVPR 106

  Fly   176 DEADLAAI----KANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFL 236
            :..::.|:    |.:|.....:||||||:..|||||.: .|...:||.|...:||.....|||..
Mouse   107 NSDEINALRDYGKRSLPGVNDFWLGINDMVTEGKFLDV-HGFAVSFLNWDRAQPSGGKRENCVLF 170

  Fly   237 ---YNGEMYDYPCHYTFRFICQ 255
               ..|:..|..|..:.|:||:
Mouse   171 SQSAQGKWSDEACRSSKRYICE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 35/118 (30%)
Clec3aNP_001007224.1 CLECT_tetranectin_like 68..193 CDD:153066 38/126 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.