DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CG34033

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001033937.1 Gene:CG34033 / 3885602 FlyBaseID:FBgn0054033 Length:168 Species:Drosophila melanogaster


Alignment Length:123 Identity:34/123 - (27%)
Similarity:57/123 - (46%) Gaps:18/123 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 YYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTH-YWLGINDLDHEGKFLSMP 210
            |:.||.:  :|.:|...|:::...|||:..|..|..:|:.:.:|.| ||.|:|..|       .|
  Fly    32 YFSEKTA--SWFSALTICKSLHMCLADLNTEVTLFQMKSKINQDDHEYWFGLNAHD-------KP 87

  Fly   211 TGKQTTFLKWASGRPSQLDTLN---CVFL-YNGEMYDY---PCHYTFRFIC-QTEEED 260
            |.:..:..|.....|.....:|   ||:: ...:.:.:   .|....|||| :|:|.|
  Fly    88 TYRYVSNNKSIEYSPHNSKLVNNEGCVYVKQQNDFFKFESAKCREHRRFICTKTDECD 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/116 (27%)
CG34033NP_001033937.1 CLECT 30..140 CDD:153057 31/116 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.