DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and tfc

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster


Alignment Length:131 Identity:38/131 - (29%)
Similarity:65/131 - (49%) Gaps:14/131 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 QIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKE----DTHYWLGINDLD 201
            ::|.|.||:....:.||..|::.||..|.|||.|..:.:...::.::::    ..|:|:...||.
  Fly   244 KLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLA 308

  Fly   202 HEGKFLSMPTGKQTTFLKWASGRPSQL-----DTLNCVFLYNGE-----MYDYPCHYTFRFICQT 256
            .||.|..|.||:..||..|.:|.|:..     :..||:.|:|.:     ..|.||.:...|:|:.
  Fly   309 DEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEV 373

  Fly   257 E 257
            :
  Fly   374 Q 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 35/122 (29%)
tfcNP_612091.1 CLECT 249..373 CDD:153057 36/123 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43824
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 1 1.000 - - X29
55.040

Return to query results.
Submit another query.