DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec4d

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001003707.2 Gene:Clec4d / 362432 RGDID:1303339 Length:218 Species:Rattus norvegicus


Alignment Length:115 Identity:31/115 - (26%)
Similarity:48/115 - (41%) Gaps:9/115 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFL---SM 209
            |......:.|..:.:.|..|..||..|..||:...:...|.|...|:||::....||::.   ..
  Rat    94 YFPLNDNQTWHESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQWVDKT 158

  Fly   210 PTGKQTTFLKWASGRPSQLDTLNCVFL-YNGEMY---DYPCHYTFRFICQ 255
            |......|  |..|.|......:||.| |:.:.:   |:|||:....||:
  Rat   159 PFNPNVVF--WKVGEPKDYMEEDCVVLVYDQDKWVWNDFPCHFEMGRICK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 30/113 (27%)
Clec4dNP_001003707.2 CLECT_DC-SIGN_like 82..206 CDD:153060 30/113 (27%)

Return to query results.
Submit another query.