DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec4a3

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001005891.1 Gene:Clec4a3 / 362431 RGDID:1359528 Length:237 Species:Rattus norvegicus


Alignment Length:259 Identity:61/259 - (23%)
Similarity:105/259 - (40%) Gaps:51/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NLYGAWAESDVICPLK-DPPSQ------CGGFCLGVLTPVLNHLTISQNLANSNNSSKANEVLVR 73
            |....:..||:....: |||.:      |..|...:.|.::.:..:...|.:|     |..:|.:
  Rat    11 NFKNKYDSSDIDTDFRPDPPKKSKSQKSCHKFSKVLFTSLIIYFLLLTILFSS-----ALIILFK 70

  Fly    74 QYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTERLNCMEGILSALEKTVLEVKTKIKYLG 138
            :|:   ||  |:.|.:              :.|.|:|| |.|.:.. |.||..|.....|    .
  Rat    71 KYS---QL--LEEKTI--------------MKELNYTE-LECTKWD-SLLEDKVWSCCPK----D 110

  Fly   139 FEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTH--YWLGINDLD 201
            ::...|..|:....|.::|..:.:.|..:|.||..|..:.:...:...|  |||  |::|::|..
  Rat   111 WKPFDSNCYFPSTDSVESWMESEEKCSGIGAHLVVIHSQEEQDFLPRIL--DTHAAYFIGLSDPG 173

  Fly   202 H-EGKFLSM-PTGKQTTFLKWASGRPSQLDTLNCVFLYNGE-----MYDYPCHYTFRFICQTEE 258
            | :.:::.. |.....||  |..|.||. |...||.:.:.|     ..|..|....:.:||.::
  Rat   174 HRQWQWVDQTPYNGNATF--WHEGEPSS-DNEQCVIINHHENTGWGWSDSSCSDKQKLVCQVKK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 29/117 (25%)
Clec4a3NP_001005891.1 CLECT_DC-SIGN_like 107..231 CDD:153060 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.