DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CG7763

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:274 Identity:78/274 - (28%)
Similarity:111/274 - (40%) Gaps:58/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKSASALLCGLLALNLYGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNSS 65
            |.||...|:..|...:.|.|      .|...:..|||..:|.|||.|.:      .::.|.....
  Fly     1 MQKSIIFLVLPLCLSSSYSA------ACEGVESDSQCAAYCYGVLNPCI------ASMGNLQRRV 53

  Fly    66 KANEVLV---------RQYTMEGQLTALQ--NKQLSIEVAL--DAQGRKLNVNEQNFTERLNCME 117
            :|.|..|         |:....|..|.||  |:..|.::..  .|.||||..||.          
  Fly    54 EACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEENEI---------- 108

  Fly   118 GILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAA 182
                                 |:|:|||||||||..:.||..|...|..||||||.::.:.:|..
  Fly   109 ---------------------FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDR 152

  Fly   183 IKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGE--MYDYP 245
            ....|.....||:.:.:..:|.:|:|:..|.:..||.||.|.|::......:..:||:  |.|..
  Fly   153 FNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDGECVDIRTFNGKTTMNDNS 217

  Fly   246 CHYTFRFICQTEEE 259
            |.....|||:...|
  Fly   218 CFANLYFICEKSIE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 37/110 (34%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 38/111 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448807
Domainoid 1 1.000 54 1.000 Domainoid score I11019
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
98.900

Return to query results.
Submit another query.