DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CG8343

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster


Alignment Length:131 Identity:28/131 - (21%)
Similarity:52/131 - (39%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 YYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIK------ANLKED---THYWLGINDLDH 202
            :.|...::.||..|..||...|..|..|..|.|..:::      |..::|   ...|....||..
  Fly    52 FAIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLAS 116

  Fly   203 EGKFLSMPTGKQTTFLKWASGRPS-QLDTLNCVFL--YNGEMYDYPCHYTFRFICQTE---EEDL 261
            :..::....|:...:..:.:|.|. ..|..:|:.:  .||...:..|.....|:|:..   ::|:
  Fly   117 DNNWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGLWVNENCSELRYFVCEKRCQFDDDV 181

  Fly   262 N 262
            |
  Fly   182 N 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 25/119 (21%)
CG8343NP_610207.1 CLECT 59..173 CDD:153057 25/113 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
33.010

Return to query results.
Submit another query.