DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Acp29AB

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster


Alignment Length:217 Identity:66/217 - (30%)
Similarity:111/217 - (51%) Gaps:25/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TP--VLNHLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQN 108
            ||  .::.:.|:||...:.|:.|.||.|....|||.::.   :..|..:..::.|.:.|.:..::
  Fly    37 TPQNTIDQIGINQNYWFTYNALKQNETLAIIDTMEMRIA---SSLLEFKAQMEIQLQPLKIIMRH 98

  Fly   109 FTERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLAD 173
            ....               ::....||...||::||::::|||...:.|..|..|||.|.||||:
  Fly    99 HASN---------------IKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLAN 148

  Fly   174 IKDEADLAAIKANLKEDTHYWLGINDL-DHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLY 237
            |:||.:|..|.| |..:..||:.|:.| ::.|.|:|..||::..|:||.|.:.::... .||::|
  Fly   149 IQDEMELDGILA-LAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQDTKKKN-QCVYIY 211

  Fly   238 NGEM-YDYPCHYTFRFICQTEE 258
            ..|| || .|.....|:||.::
  Fly   212 AKEMSYD-ECFEKKSFVCQADQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 42/110 (38%)
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 42/110 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448785
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
76.800

Return to query results.
Submit another query.