DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CLEC4G

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_940894.1 Gene:CLEC4G / 339390 HGNCID:24591 Length:293 Species:Homo sapiens


Alignment Length:256 Identity:66/256 - (25%)
Similarity:95/256 - (37%) Gaps:39/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKSAS----ALLCG--LLALNLYGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLA 59
            :|..||    |||.|  ||..|   |..::..:..||:....|...|.|         |.:|...
Human    52 LLSKASTERAALLDGHDLLRTN---ASKQTAALGALKEEVGDCHSCCSG---------TQAQLQT 104

  Fly    60 NSNNSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTERLNCMEGILSALE 124
            ......:|...|:.|   |..|..|:.:   :...|...||.   .|...||....:|.:  .|:
Human   105 TRAELGEAQAKLMEQ---ESALRELRER---VTQGLAEAGRG---REDVRTELFRALEAV--RLQ 158

  Fly   125 KTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKE 189
            ....| .....:|.||  ||.|::  .|.:..|:.|...|.:...||..:....:...:..|.: 
Human   159 NNSCE-PCPTSWLSFE--GSCYFF--SVPKTTWAAAQDHCADASAHLVIVGGLDEQGFLTRNTR- 217

  Fly   190 DTHYWLGINDLDHEGKF--LSMPTGKQTTFLKWASGRPSQL-DTLNCV-FLYNGEMYDYPC 246
            ...||||:..:.|.||.  .....|...:|..|..|.|:.. ...||| .|:.|...|.||
Human   218 GRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPC 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 28/105 (27%)
CLEC4GNP_940894.1 ATG16 63..>156 CDD:312208 27/115 (23%)
CLECT 165..289 CDD:321932 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.