DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and lectin-37Db

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster


Alignment Length:120 Identity:44/120 - (36%)
Similarity:65/120 - (54%) Gaps:6/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 QIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGK 205
            :||.|.||| .:::.||..||..||..||.|.:::...:|..:..:|.....|||.||||...|.
  Fly    30 EIGEKQYYI-SLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPAYSYWLSINDLGERGV 93

  Fly   206 FLSMPTGKQTTFLKWASGRPSQLDTLN-CVFLY----NGEMYDYPCHYTFRFICQ 255
            ::|..||.:..||.|::|.|......: ||.|:    :.:|.|.||:.:..||||
  Fly    94 YVSEATGLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQ 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 39/113 (35%)
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 40/114 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.