DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CG2839

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster


Alignment Length:286 Identity:80/286 - (27%)
Similarity:145/286 - (50%) Gaps:35/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKSASALLCGLLALNLYGAWAESDVICPLKDP-------PSQCGGFCLGVLTPVLNHLTISQNL 58
            |.:.|:..|....:......:||:|:   |:||       ..:.|..||..:.|:|.:::..|..
  Fly     1 MFECATYFLFVFFSYGSCNVFAENDI---LQDPLISSYDRLKKLGEMCLIDILPILENISEQQKE 62

  Fly    59 ANSNNSSKANE---VLVR----QYTMEGQLTALQNKQ----LSIEVALDAQGRKLNVNEQNFTER 112
            ..:.|....||   :|.|    |...:.||.||:.|.    :.:...::.:.:||:: |::..:.
  Fly    63 GYTANFRIFNETQGILDRIEGHQEVNDKQLKALKVKMEGHFMDLHAKMEIKVKKLSL-EKSLRKA 126

  Fly   113 LNCMEGILSALEKTVLEVKTKIK-YLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKD 176
            ||.::..|.     ...|.:|:. :..||::||:::|||:..::||..|...||.||||||..::
  Fly   127 LNALQCSLD-----TRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQN 186

  Fly   177 EADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEM 241
            |.:|..|...|..:: |||.::||...|:::|:.:|.:..||||..|:|:: :...||.:..|..
  Fly   187 EEELHLISQKLDTES-YWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNR-ENAQCVRVKGGLY 249

  Fly   242 YDYPCHYTFRFICQT-----EEEDLN 262
            ..:.|.:...||||.     :|:::|
  Fly   250 QTFQCDHRVLFICQANQNRKKEDEIN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 38/108 (35%)
CG2839NP_608540.1 CLECT 147..263 CDD:214480 42/117 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448776
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.