DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CG12111

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster


Alignment Length:163 Identity:52/163 - (31%)
Similarity:76/163 - (46%) Gaps:26/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 FTE-RLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLA 172
            ||. |.....||.|.::.|           .|.:||..|||||.:::.||..|:..||.|..|||
  Fly    28 FTNYRTEVYNGIPSEIDTT-----------PFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLA 81

  Fly   173 DIKDEADLAAI----KA-NLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQL---- 228
            .|:|:.::.|:    || ..|.:.::|:..|||..||.|..|..|:..|:..|  ..|.|:    
  Fly    82 SIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPW--NGPKQMPDNY 144

  Fly   229 -DTLNCVFLY-NGEMY-DYPCHYTFRFICQTEE 258
             ...|||.:: ..||. |..|.....::|:..|
  Fly   145 GGNENCVHMFATREMINDANCKIQMLYVCEATE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 40/120 (33%)
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 40/120 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43824
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.