DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Colec10

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:150 Identity:45/150 - (30%)
Similarity:71/150 - (47%) Gaps:18/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ILSALEKTVLEVKTKIKYL-----GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDE- 177
            ::..|:.:|..:||.:|::     |..:...|:|||.: .|||:..:...||..||.||..||| 
  Rat   127 VVGQLDISVARLKTSMKFIKNVIAGIRETEEKFYYIVQ-EEKNYRESLTHCRIRGGMLAMPKDEV 190

  Fly   178 -----ADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQ-LDTLNCV-F 235
                 ||..|.....:    .::|:|||:.||:::.........:..|..|.||. ....:|| .
  Rat   191 VNTLIADYVAKSGFFR----VFIGVNDLEKEGQYVFTDNTPLQNYSNWKEGEPSDPYGHEDCVEM 251

  Fly   236 LYNGEMYDYPCHYTFRFICQ 255
            |.:|...|..||.|..|:|:
  Rat   252 LSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 37/116 (32%)
Colec10NP_001124013.1 Collagen 45..94 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 39/119 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10071
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5161
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45908
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.