DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and CLEC2D

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001004419.1 Gene:CLEC2D / 29121 HGNCID:14351 Length:194 Species:Homo sapiens


Alignment Length:113 Identity:26/113 - (23%)
Similarity:48/113 - (42%) Gaps:25/113 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RLNCMEGILSALEKTV-LEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIK 175
            |.||.:      |.:| |:......::||::   |.:|... ..|||:::.:.|.:....||.::
Human    60 RANCHQ------EPSVCLQAACPESWIGFQR---KCFYFSD-DTKNWTSSQRFCDSQDADLAQVE 114

  Fly   176 DEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASG 223
            ...:|..: ...|..:.:|:|          ||...|:.   .||.:|
Human   115 SFQELNFL-LRYKGPSDHWIG----------LSREQGQP---WKWING 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 17/78 (22%)
CLEC2DNP_001004419.1 CLECT_NK_receptors_like 75..171 CDD:153063 20/92 (22%)

Return to query results.
Submit another query.