DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Sftpd

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_037010.1 Gene:Sftpd / 25350 RGDID:3667 Length:374 Species:Rattus norvegicus


Alignment Length:151 Identity:42/151 - (27%)
Similarity:69/151 - (45%) Gaps:11/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 ERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIK 175
            :::..:.|.|..||......|....:...:.:|.|.:.... ||:.:..|.:.||..||.||..:
  Rat   228 QQMEALNGKLQRLEAAFSRYKKAALFPDGQSVGDKIFRAAN-SEEPFEDAKEMCRQAGGQLASPR 291

  Fly   176 DEADLAAIK----ANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQL-DTLNCVF 235
            ...:.||::    |:.|.   .:|.:.|:..|||| :.|||:...:..||.|.|:.. ...|||.
  Rat   292 SATENAAVQQLVTAHSKA---AFLSMTDVGTEGKF-TYPTGEALVYSNWAPGEPNNNGGAENCVE 352

  Fly   236 LY-NGEMYDYPCHYTFRFICQ 255
            :: ||:..|..|......||:
  Rat   353 IFTNGQWNDKACGEQRLVICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 34/114 (30%)
SftpdNP_037010.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..221
gly_rich_SclB <60..>219 CDD:468478
Surfac_D-trimer 223..268 CDD:286141 7/39 (18%)
CLECT 261..374 CDD:470576 36/118 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.