DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Mbl1

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_036731.2 Gene:Mbl1 / 24548 RGDID:3055 Length:238 Species:Rattus norvegicus


Alignment Length:161 Identity:39/161 - (24%)
Similarity:73/161 - (45%) Gaps:7/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 QGRKLNVNEQNFTE-RLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTAS 161
            :|:|.:..:....| :|..||..::.| |:.||:..|:......:...|.:::.......:|...
  Rat    79 KGQKGDRGDSRAIEVKLANMEAEINTL-KSKLELTNKLHAFSMGKKSGKKFFVTNHERMPFSKVK 142

  Fly   162 KTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPS 226
            ..|..:.|.:|..::..:..||:...|  |..:|||.|...||:|:.: ||.:.|:..|....|:
  Rat   143 ALCSELRGTVAIPRNAEENKAIQEVAK--TSAFLGITDEVTEGQFMYV-TGGRLTYSNWKKDEPN 204

  Fly   227 QLDT-LNCVFLY-NGEMYDYPCHYTFRFICQ 255
            ...: .:||.:. ||...|..|..:...:|:
  Rat   205 DHGSGEDCVTIVDNGLWNDISCQASHTAVCE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 26/110 (24%)
Mbl1NP_036731.2 Collagen 36..>88 CDD:189968 2/8 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..87 2/7 (29%)
CLECT_collectin_like 126..236 CDD:153061 28/113 (25%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386 202..210 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.