DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Colec10

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_775598.2 Gene:Colec10 / 239447 MGIID:3606482 Length:277 Species:Mus musculus


Alignment Length:150 Identity:44/150 - (29%)
Similarity:70/150 - (46%) Gaps:18/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ILSALEKTVLEVKTKIKYL-----GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDE- 177
            ::..|:.:|..:||.:|::     |..:...|:|||.: .|||:..:...||..||.||..||| 
Mouse   127 VVGQLDISVARLKTSMKFIKNVIAGIRETEEKFYYIVQ-EEKNYRESLTHCRIRGGMLAMPKDEV 190

  Fly   178 -----ADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQ-LDTLNCV-F 235
                 ||..|.....:    .::|:|||:.||:::.........:..|....||. ....:|| .
Mouse   191 VNTLIADYVAKSGFFR----VFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGHEDCVEM 251

  Fly   236 LYNGEMYDYPCHYTFRFICQ 255
            |.:|...|..||.|..|:|:
Mouse   252 LSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 36/116 (31%)
Colec10NP_775598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..103
Collagen 45..93 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 38/119 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10387
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43824
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.