DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Colec10

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_775598.2 Gene:Colec10 / 239447 MGIID:3606482 Length:277 Species:Mus musculus


Alignment Length:150 Identity:44/150 - (29%)
Similarity:70/150 - (46%) Gaps:18/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ILSALEKTVLEVKTKIKYL-----GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDE- 177
            ::..|:.:|..:||.:|::     |..:...|:|||.: .|||:..:...||..||.||..||| 
Mouse   127 VVGQLDISVARLKTSMKFIKNVIAGIRETEEKFYYIVQ-EEKNYRESLTHCRIRGGMLAMPKDEV 190

  Fly   178 -----ADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQ-LDTLNCV-F 235
                 ||..|.....:    .::|:|||:.||:::.........:..|....||. ....:|| .
Mouse   191 VNTLIADYVAKSGFFR----VFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGHEDCVEM 251

  Fly   236 LYNGEMYDYPCHYTFRFICQ 255
            |.:|...|..||.|..|:|:
Mouse   252 LSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 36/116 (31%)
Colec10NP_775598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..103
gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 38/119 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.