DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Clec3b

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_035736.2 Gene:Clec3b / 21922 MGIID:104540 Length:202 Species:Mus musculus


Alignment Length:231 Identity:56/231 - (24%)
Similarity:95/231 - (41%) Gaps:50/231 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GGFCLGVLTPVLNHLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQ--LSIEVALDAQGR 100
            |.:.|..|...|:.:........:..::.|.:.||.....|    .|:|:.  |:.||||     
Mouse     5 GTYLLFCLFSFLSQVIAESPTPKAKKAANAKKDLVSSKMFE----ELKNRMDVLAQEVAL----- 60

  Fly   101 KLNVNEQNFTERLNCMEGILSALEKTVLEVKTKIK-YLGFEQIGSKYYYIEKVSEKNWSTASKTC 164
               :.|:...:.: |::|           .|..:| .|.|.|            .|.:..||:.|
Mouse    61 ---LKEKQALQTV-CLKG-----------TKVNLKCLLAFTQ------------PKTFHEASEDC 98

  Fly   165 RNMGGHL----ADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRP 225
            .:.||.|    :::::||.....:.::..|.:.|||:||:..||.::.| ||....:..|.:...
Mouse    99 ISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDM-TGGLLAYKNWETEIT 162

  Fly   226 SQLD---TLNCVFL---YNGEMYDYPCHYTFRFICQ 255
            :|.|   ..||..|   .||:.:|..|.....:|||
Mouse   163 TQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/118 (26%)
Clec3bNP_035736.2 CLECT_tetranectin_like 71..199 CDD:153066 40/152 (26%)

Return to query results.
Submit another query.