DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Sftpd

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_033186.1 Gene:Sftpd / 20390 MGIID:109515 Length:374 Species:Mus musculus


Alignment Length:148 Identity:40/148 - (27%)
Similarity:68/148 - (45%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 ERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIK 175
            :::..::|.|..||......:....:.....:|.|.:.... |||.:..|.:.|:..||.||..:
Mouse   228 QQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTAD-SEKPFEDAQEMCKQAGGQLASPR 291

  Fly   176 DEADLAAIKANL-KEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQL-DTLNCVFLY- 237
            ...:.|||:..: ..:...:|.:.|:..|||| :.|||:...:..||.|.|:.. ...|||.:: 
Mouse   292 SATENAAIQQLITAHNKAAFLSMTDVGTEGKF-TYPTGEPLVYSNWAPGEPNNNGGAENCVEIFT 355

  Fly   238 NGEMYDYPCHYTFRFICQ 255
            ||:..|..|......||:
Mouse   356 NGQWNDKACGEQRLVICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 33/111 (30%)
SftpdNP_033186.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..222
Collagen 45..102 CDD:189968
Collagen 129..>171 CDD:189968
Surfac_D-trimer 223..267 CDD:286141 6/38 (16%)
CLECT_collectin_like 261..374 CDD:153061 35/115 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10387
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43824
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.