DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Sftpd

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_033186.1 Gene:Sftpd / 20390 MGIID:109515 Length:374 Species:Mus musculus


Alignment Length:148 Identity:40/148 - (27%)
Similarity:68/148 - (45%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 ERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIK 175
            :::..::|.|..||......:....:.....:|.|.:.... |||.:..|.:.|:..||.||..:
Mouse   228 QQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTAD-SEKPFEDAQEMCKQAGGQLASPR 291

  Fly   176 DEADLAAIKANL-KEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQL-DTLNCVFLY- 237
            ...:.|||:..: ..:...:|.:.|:..|||| :.|||:...:..||.|.|:.. ...|||.:: 
Mouse   292 SATENAAIQQLITAHNKAAFLSMTDVGTEGKF-TYPTGEPLVYSNWAPGEPNNNGGAENCVEIFT 355

  Fly   238 NGEMYDYPCHYTFRFICQ 255
            ||:..|..|......||:
Mouse   356 NGQWNDKACGEQRLVICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 33/111 (30%)
SftpdNP_033186.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..222
gly_rich_SclB <60..>219 CDD:468478
Surfac_D-trimer 223..267 CDD:286141 6/38 (16%)
CLECT_collectin_like 261..374 CDD:153061 35/115 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.