DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and Y38H6C.8

DIOPT Version :10

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_507951.1 Gene:Y38H6C.8 / 189689 WormBaseID:WBGene00012621 Length:158 Species:Caenorhabditis elegans


Alignment Length:127 Identity:33/127 - (25%)
Similarity:54/127 - (42%) Gaps:15/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LGFEQIGSKYYYIEKVSEKNWSTASKTCRNM-GGHLADIKDEAD---LAAIKAN-LKED-THYWL 195
            :||   |...|...:|..| :..|:..|..| ||.|..|.:..|   :..:..| |..| ..:|:
 Worm    23 VGF---GDSCYSFNRVHGK-FKDANDLCVKMFGGSLVKITNIIDNNWMQKLAVNHLDADYNSFWI 83

  Fly   196 GINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNC--VFLYNGEMYDYPCHYTFRFICQ 255
            |.:|..|...: :...|....|..|..|:|  |:..:|  :.:..|:.:...|....:|:||
 Worm    84 GASDAAHYTNW-TWIDGSPMRFSNWGPGQP--LEDRHCGTMLISTGKWFSQVCDERIQFLCQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 28/116 (24%)
Y38H6C.8NP_507951.1 CLECT 18..142 CDD:214480 31/125 (25%)

Return to query results.
Submit another query.