DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-22C and clec-149

DIOPT Version :9

Sequence 1:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_497267.2 Gene:clec-149 / 186903 WormBaseID:WBGene00019328 Length:308 Species:Caenorhabditis elegans


Alignment Length:237 Identity:64/237 - (27%)
Similarity:107/237 - (45%) Gaps:42/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQNKQLSI 91
            |.|::.|          |..|:..   |||. .|.|:..:|             |.|..:|:| .
 Worm   103 ISPIRPP----------VPMPIPQ---ISQG-CNCNHDIEA-------------LEAKFDKKL-Y 139

  Fly    92 EVALDAQ---GRKLNVNEQNFTERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGS---KYYYIE 150
            ||.:.||   .:.:....:.|...|...|.|.:   |.::|:|..:.||...:|.:   :|::|:
 Worm   140 EVKMHAQYETEKGVGDLRKQFETDLREYERITT---KDIVEIKRHLDYLQAPRITNNDLEYFFIQ 201

  Fly   151 KVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQT 215
            :  |::|.|||:.|...|.|||.|....:|..::..:..:...|:|:||:..|..|.: ..|...
 Worm   202 R--EESWYTASEKCIGYGAHLASIHSRLELGFVQRLVPVNQTAWIGVNDIQKENVFRN-SDGTPV 263

  Fly   216 TFLKWASGRP-SQLDTLNCVFL-YNGEMYDYPCHYTFRFICQ 255
            .|.||...:| :|....|||.: ::|:..|..|..|..|:|:
 Worm   264 DFYKWGKKQPDNQEHNENCVEVDHSGQWTDKLCIITRPFVCK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 34/110 (31%)
clec-149NP_497267.2 CLECT 197..306 CDD:153057 35/112 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto19161
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.